DPCstruct | MC35010
Metacluster Properties and Pfam Annotations
| Number of structural domains | 181 |
|---|---|
| Mean domain length (aa) | 210 ± 52 aa |
| Standard deviation of domain lengths | 52.34 |
| Length coefficient of variation | 0.25 |
| Mean AlphaFold2 pLDDT confidence score | 74.81 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.58 |
| Mean intra-cluster local Distance Difference Test score | 0.56 |
| Mean intra-cluster sequence similarity (%) | 25.79 |
| Pfam Score | 60.00 |
| Assigned Pfam label(s) | PF06985- CL0568 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0C9YJJ8 | 1-226 | MSWAADRKTTRVEDRAYSLLGLFGVNMPMLYGEGLKAFQRLQLEITRVSSDHSIFAWNPKGQLGKYGSVLADDPSCFRGCHNVKNMD… |
| A0A6A5ZN99 | 106-285 | SWAAGRETTRPEDRAYSLMGLFDVQMPILYGEGLQNAFARLLDEIMKTSFDQTIFAWRGPYEESGLLAPNPDVYQDTPTLRLWRPDY… |
| A0A3M9Y178 | 219-427 | None |
| A0A1B7Y7Z5 | 289-588 | None |
| S3BUI6 | 161-388 | None |
| A0A1V6SU14 | 185-372 | None |
| A0A229YDM9 | 676-930 | None |
| A0A5M9LPG7 | 1-212 | None |
| A0A0D2DZ02 | 183-460 | None |
| A0A6G1IW75 | 1-134 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.