DPCstruct | MC3501
Metacluster Properties and Pfam Annotations
| Number of structural domains | 31 |
|---|---|
| Mean domain length (aa) | 113 ± 38 aa |
| Standard deviation of domain lengths | 37.83 |
| Length coefficient of variation | 0.34 |
| Mean AlphaFold2 pLDDT confidence score | 87.84 |
| Mean fraction of residues predicted as intrinsically disordered | 0.97 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.94 |
| Mean intra-cluster sequence similarity (%) | 78.37 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF21107 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4Y2U5Q1 | 1-122 | MPKRKRGITGDAASRREAIRKRERRVVETEEERSRRLSTMAQRGQNRRAEETEEQRNSRLSDMAQRGQERRAEETEEQRIRRLAVMG… |
| A0A4Y2JSR3 | 1-122 | MPKRKRGITGDAASRREAIRKRERRVVETEEERSRRLSTMAQRGQDRRAEETEEQRNSRLSDMAQRGQERRAEETEEQRNSRLAVMA… |
| A0A4Y2UD01 | 1-127 | None |
| A0A4Y2UP34 | 1-110 | None |
| A0A4Y2CA75 | 1-118 | None |
| A0A4Y2AH24 | 1-118 | None |
| A0A4Y2T7V1 | 1-98 | None |
| A0A4Y2TMR8 | 1-86 | None |
| A0A4Y2SRK8 | 1-113 | None |
| A0A4Y2VQI8 | 1-116 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.