DPCstruct | MC35009
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 365 ± 48 aa |
| Standard deviation of domain lengths | 48.13 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 68.85 |
| Mean fraction of residues predicted as intrinsically disordered | 0.62 |
| Mean length-normalized TM-Score | 0.51 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 28.48 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF10198 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0C9YHJ8 | 17-368 | RPPVAPPPAPGPSKPTEVKEDFSKLKQPPQVPVTTFYSSIEPWIRGIKEEDIGFLEFTGDEIEPYVVPKLGRHYTEVWEEQDTEIYG… |
| A0A3G2S378 | 222-540 | TVPGHVPPSSAARPRPAKEAAQVPATTFFHYVDAYFKPVTEDDLAWLSSQADDPSPYVFPELGVHYRKIWEKEDAELQSVLQAMEGH… |
| A0A2G8RYT8 | 1-438 | None |
| I1BTY5 | 2-305 | None |
| A0A077W6V9 | 209-531 | None |
| C1GR17 | 306-675 | None |
| A0A146I9D8 | 145-558 | None |
| A0A0D0U4G6 | 75-437 | None |
| U1HSF5 | 104-495 | None |
| Q0CRD2 | 627-1003 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.