DPCstruct | MC35007
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 106 ± 6 aa |
| Standard deviation of domain lengths | 5.91 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 85.55 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 30.73 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF20414 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A409W9Z8 | 96-199 | MIAAAGPARSDDISSLKCFALVCTAECEDNGKLDTPIHPAAPKTRSRGFNQPQLARLLTPVKLISDFDKDPKEFIKGVGNGTIKIRA… |
| A0A0C9XTB3 | 1-116 | MHKMQQTISWTKSDDASHLKAMISSYVAPHPDKKSVDPPLNVKGSKDRLGFNHPELACLLCPVRNLQEFLEDPAEVKKQLQNGGILV… |
| A0A5C3LEI3 | 56-168 | None |
| A0A0C9T4S4 | 155-258 | None |
| A0A0C3NFS3 | 75-191 | None |
| A0A0C9SWC2 | 2-102 | None |
| W4JU78 | 6-107 | None |
| A0A0W0FWU3 | 4-103 | None |
| A0A165MLR0 | 93-195 | None |
| A0A0D0DNE6 | 15-118 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.