DPCstruct | MC35003
Metacluster Properties and Pfam Annotations
| Number of structural domains | 61 |
|---|---|
| Mean domain length (aa) | 131 ± 22 aa |
| Standard deviation of domain lengths | 22.18 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 87.56 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.58 |
| Mean intra-cluster sequence similarity (%) | 21.64 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0G1XT16 | 5-120 | LTSTLLGGGYFGFDYGTTRHNDLWYYDEYDAQIGTPVGSPVNVLNPANKTLAPSVWQRDFSGGKVIVNATSEPQRIQLGGEYEHLRG… |
| A0A7C5APH6 | 234-371 | LLESRRVGNAQERLFSLASYLLLKGRHTFFDLELSPEPEWWPEYTIPIGAYEGDIPHTLNELYDPAWGLYRRRYENGLVLVNPTELP… |
| A0A1Q5A739 | 16-152 | None |
| A0A7X3NUE8 | 373-488 | None |
| A0A7X3NTH6 | 205-329 | None |
| A0A511R062 | 378-497 | None |
| A0A7V9SVJ9 | 64-172 | None |
| A0A3B8XPE9 | 626-762 | None |
| A0A1F9C2W0 | 311-467 | None |
| A0A7Y4NZW0 | 295-413 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.