DPCstruct | MC35002
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 127 ± 15 aa |
| Standard deviation of domain lengths | 15.03 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 77.39 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 31.87 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0D2XU60 | 437-541 | QDEPAKEFWFDFGPPNTLSENDFKKHFGHLKFDTALQYVGFPQVRLKGSREQPDVRHQGRKDMVFFFDWLRAKPVTRIIKVVVEDME… |
| G4ND77 | 1-128 | MSPQQAFDYMHVHDQKDKKLWYDFGPEPEAKISEKDFRKQFRHMDFDSVLQYVAFPRIELGKDADEGENETDELHRGRQDTISLFKW… |
| A0A2N1M095 | 314-433 | None |
| A0A428TQM8 | 349-465 | None |
| X0ME24 | 340-478 | None |
| A0A7C8L8D6 | 165-277 | None |
| A0A0D2XFL4 | 349-471 | None |
| A0A6A5U0A5 | 189-327 | None |
| A0A428UXU8 | 192-314 | None |
| A0A4Z1IRN6 | 420-534 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.