DPCstruct | MC35000
Metacluster Properties and Pfam Annotations
| Number of structural domains | 34 |
|---|---|
| Mean domain length (aa) | 289 ± 39 aa |
| Standard deviation of domain lengths | 38.91 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 77.10 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.60 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 24.81 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6A4VNW2 | 1-292 | MAANECMYFYEDEVYRITKRGNLEFGMVLQNADVDTDEEESGSEEMEKLKNGHILVAWHPRGEEDVIHEKKVGLSDRCLMPGDIVRR… |
| R7W0H4 | 27-284 | GLVISYATENDTYTYRLFRLDGTMVTKKADEIPVLERSSIHVGQFVVSTTDAGGQIGVVTGVATDLHVAQIDGRGKVGKQILGVSTA… |
| A0A396I2R1 | 1-276 | None |
| A0A0D3DHS3 | 229-474 | None |
| A0A2K1JBY4 | 1-344 | None |
| A0A1D6FDR7 | 29-334 | None |
| T1FSX2 | 1-303 | None |
| A0A3M6U3Q4 | 1-289 | None |
| A0A835F4D3 | 9-269 | None |
| A0A1D6MC51 | 101-374 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.