DPCstruct | MC350
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 159 ± 14 aa |
| Standard deviation of domain lengths | 14.49 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 84.93 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 24.53 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5N5NH98 | 260-415 | AEYVSGERPEKFAEFVRTRWRDEGSILVGTIGENAINDASVPCIDGTMDSLGNVYLPTPPLKRLCARFLREGEFFPWLRVEEPVQVQ… |
| A0A366RXU1 | 23-173 | YVVTYARKNPGDFLSYLRRVWPEYRERLAENPGCLRFLGRSKVLENGETRKIHKTWIPLLELRRLQSRYLLLGENASFPRLDPLLPE… |
| F0XU60 | 664-813 | None |
| A0A366PPK9 | 1-175 | None |
| A0A4Y9YC88 | 91-237 | None |
| U7PN65 | 711-848 | None |
| A0A178AQQ2 | 433-578 | None |
| A0A084B4L8 | 2-167 | None |
| A0A559LR17 | 28-191 | None |
| C7ZML2 | 17-190 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.