DPCstruct | MC35
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 98 ± 5 aa |
| Standard deviation of domain lengths | 4.89 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 89.92 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.88 |
| Mean intra-cluster sequence similarity (%) | 59.61 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7W5TAU1 | 2-97 | RPAFDAGVALTRLDERIARSLVGAGWIERQSFADACASLWIDGELVHLEDLVLHDATRDIRTPTHELTIARDVLRTRRRIAGQSPDW… |
| J2W2J8 | 1-89 | MLTSLDERIARSPLSEGFGERSHFTDACASLWIDGELVHLEDLVLHDATRDIRTPTHELTIARDVLKTRRRIAVQAPDWALSPDGLR… |
| A0A521QGX5 | 18-112 | None |
| A0A559TKY6 | 1-103 | None |
| A0A2V4UJH5 | 18-113 | None |
| A0A2S0XRV9 | 16-116 | None |
| A0A1S7U792 | 1-104 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.