DPCstruct | MC34999
Metacluster Properties and Pfam Annotations
| Number of structural domains | 67 |
|---|---|
| Mean domain length (aa) | 101 ± 18 aa |
| Standard deviation of domain lengths | 17.91 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 84.73 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 41.78 |
| Pfam Score | 87.68 |
| Assigned Pfam label(s) | CL0110- PF12357- CL0479 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A314YQZ8 | 100-216 | MGAYQPYHLSVREPARGQIHGFRMALWYEHLGMLDEKFLQPESVECVTKVNQIADKYWDLYSSESLNHDLPGHLLRYPIGISSEGTV… |
| R7W0A5 | 20-116 | QVYGYRNSLWAEHLGMVDDHFKEPSSLDCVRLVNQIAEENWERFASEEMKTLQGHLLRYPVKVEPDGKIVPLPDQECFPDVGGKICG… |
| A0A7N2KQA5 | 77-177 | None |
| A0A444XD59 | 697-795 | None |
| A0A444X101 | 255-357 | None |
| A0A022RDJ8 | 19-114 | None |
| A0A7N2LE82 | 252-367 | None |
| A0A1X6PIM8 | 1027-1143 | None |
| A0A446XZ35 | 35-150 | None |
| A0A835H439 | 15-118 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.