DPCstruct | MC34997
Metacluster Properties and Pfam Annotations
| Number of structural domains | 140 |
|---|---|
| Mean domain length (aa) | 406 ± 82 aa |
| Standard deviation of domain lengths | 82.06 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 84.33 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.58 |
| Mean intra-cluster local Distance Difference Test score | 0.53 |
| Mean intra-cluster sequence similarity (%) | 21.74 |
| Pfam Score | 98.50 |
| Assigned Pfam label(s) | PF00305- CL0063- CL0321 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| N1R1J6 | 48-501 | ALHDQLFQKIPFVRKIQENSEGLLRYDTPDIIKKDKFAWLRDDEFARQALAGINPVNIQRLQVFPPVSRLDPAVYGPPGAALTEEHI… |
| A0A453H5G4 | 18-334 | STITAAHIQKNLEGLTVQQALESNRLYILDHHDRFMPFLIEVNNLPGNFIYATRTLFFLRGDGRLTPLAIELSEPVIQGGLTIAKSK… |
| A0A6P8HBU0 | 49-393 | None |
| A0A7S2UEN7 | 31-531 | None |
| A0A7N0VBI8 | 7-380 | None |
| A0A7N2LAR2 | 5-300 | None |
| A0A2B4STF2 | 96-487 | None |
| A0A7J0GDF7 | 3-317 | None |
| A0A7M5UI27 | 107-444 | None |
| A0A7N8XJ22 | 7-296 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.