DPCstruct | MC34995
Metacluster Properties and Pfam Annotations
| Number of structural domains | 56 |
|---|---|
| Mean domain length (aa) | 95 ± 16 aa |
| Standard deviation of domain lengths | 15.84 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 89.96 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 35.82 |
| Pfam Score | 82.69 |
| Assigned Pfam label(s) | CL0369- CL0036 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| N1QT00 | 111-196 | DIFYDHFFTWGFKDEIAALMAIRKRNGITAMSALKILMHEGDAYVAEIDGKVVVKIGSRYDVGAVIPVGFATSAHGNGYAVWCRGN |
| A0A482UUN3 | 100-195 | IMGYAYILTHPGTPCVFWTDWNIGSIQSAVKTLIAARRKAAIGATTSINISVYTGGLYAAYVGSHLAVKLGTNSWSPSDSTFKLYAS… |
| A0A7S2T1E8 | 99-191 | None |
| A0A5B8MJ06 | 906-998 | None |
| K8F0M6 | 1142-1243 | None |
| K8EQE6 | 327-449 | None |
| A0A0D2MH55 | 156-259 | None |
| A0A812WUW3 | 49-155 | None |
| A0A7X8JN88 | 61-154 | None |
| M7YPV5 | 307-404 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.