DPCstruct | MC34994
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 86 ± 6 aa |
| Standard deviation of domain lengths | 5.81 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 83.30 |
| Mean fraction of residues predicted as intrinsically disordered | 0.57 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 52.27 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| N1QSR2 | 3-103 | ETDEQKVVRLQALVAFGKAAHAEAMRYSDMEEEEVVEEYRRAGKLHTYDQDKEWKKRFARVAKLHPCPWGKQMVAKIEEYMYYLEED… |
| A0A835EQ38 | 4-85 | MTPEERSAAMAFIWAAIRDLEEYMDMTEEDLEDQYRRAGKLHKYDPEMELKKRYARVAKKQPPPAGLVPKMDEYLKLIEDED |
| K3XQM2 | 6-88 | None |
| A0A3L6SLM8 | 36-121 | None |
| A0A3L6R1V7 | 160-243 | None |
| A0A835AE38 | 14-99 | None |
| A0A835ET83 | 22-106 | None |
| M8C974 | 27-114 | None |
| J3KXG4 | 54-139 | None |
| A0A835E1Q2 | 62-153 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.