DPCstruct | MC34993
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 221 ± 17 aa |
| Standard deviation of domain lengths | 16.97 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 75.01 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.60 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 26.56 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| N1QPS2 | 1-221 | MVAAESFVSTGASASDTVVDYTVDEDEFHKIRLLHCDFFIRKVPDPDQDVYDFREMYVTPPDTDIYSIPRVLAPMPQKYVRCVKKNF… |
| K7V1L1 | 128-348 | MVAADSFVSTRDSASDTVVDYAVDEDEFHKIRLLHCDFLIRKVPDPDDDVFDFREMYVTPPDTDIYSIPRVLAPMPQKYARCTKKNF… |
| A0A061S161 | 81-265 | None |
| K8F4W8 | 792-1013 | None |
| A0A151TSH8 | 1-249 | None |
| A4RS47 | 480-707 | None |
| A0A6G1E0H7 | 20-242 | None |
| A0A2P6VBA2 | 42-266 | None |
| A0A7S0PVB4 | 640-877 | None |
| A0A250X901 | 197-396 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.