DPCstruct | MC34991
Metacluster Properties and Pfam Annotations
| Number of structural domains | 55 |
|---|---|
| Mean domain length (aa) | 161 ± 31 aa |
| Standard deviation of domain lengths | 31.39 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 82.70 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.58 |
| Mean intra-cluster local Distance Difference Test score | 0.57 |
| Mean intra-cluster sequence similarity (%) | 24.25 |
| Pfam Score | 98.00 |
| Assigned Pfam label(s) | PF10283- CL0361 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| S7PU88 | 7-134 | LHLTELHLGDRCLDGVLNNNNYESDILKNYLAARGLTWKNVLTESLVALQRGVFLLSDYRVTGSTVLCYCCGLRSFRELAYQYRQNI… |
| A0A4Q9QAS5 | 163-318 | EDKCSRCESVGGLSLLGVNNMILLSGLLPVHERTWLLPGVLHRNREERKLITAHLSDTQNPISEKDIFREMVELDIASTVFDTYSEE… |
| A0A3P7LFE3 | 3-103 | None |
| J4GRE3 | 968-1165 | None |
| A0A4S8IQV8 | 297-429 | None |
| A0A1I8F932 | 357-508 | None |
| A0A5K4FES8 | 17-170 | None |
| A0A0D9XPL7 | 267-378 | None |
| A0A813DVU1 | 658-796 | None |
| A0A7M3RN98 | 730-896 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.