DPCstruct | MC3499
Metacluster Properties and Pfam Annotations
| Number of structural domains | 41 |
|---|---|
| Mean domain length (aa) | 173 ± 30 aa |
| Standard deviation of domain lengths | 30.16 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 76.80 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.54 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 23.75 |
| Pfam Score | 97.62 |
| Assigned Pfam label(s) | CL0314- CL0087 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2K6Q8S3 | 1-126 | RKEKEPVVAETVEEKKEPILVCPPLRSQAYTPPEDLQSRLESYVKEVFGSSLPSNWQDISLEDSRLKFNLLAHLADDLGHVVPNSRL… |
| A0A4Y2JL89 | 36-191 | KYKRPEDLEDPLYYGKGPKKEVQTALQAIADRGFGRELPSYQPPIDLNEQLHKICKKVFGSDLSSTWKEQPLNDPLMKYKVLTKCIE… |
| A0A1X7UA67 | 14-144 | None |
| A0A653DFD6 | 1-139 | None |
| A0A4C1TT07 | 7-168 | None |
| A0A674G6U7 | 75-230 | None |
| A0A1X2G9Q2 | 12-178 | None |
| A0A835NHS9 | 3-133 | None |
| A0A2C9JQ40 | 32-203 | None |
| A0A6A4JJE3 | 200-408 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.