DPCstruct | MC34987
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 182 ± 21 aa |
| Standard deviation of domain lengths | 21.09 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 87.51 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 26.41 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0126 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0Q4QJ67 | 1-203 | MIFILLIFLVILLLIWLDHNYLAKMKKWSYFVSQSGMTGAEIAKQLLLKYELSGIQIIIADGEFTDNYDPNKKTIGLSQDIYYGNSL… |
| A0A660YK72 | 10-210 | FLLLLPVFAFSIWAQYRVKQTFEKYSKVASIRGLTGRDAAAGILSASGLGNIKIENIRGELTDHYDPRSGTLRLSDSTAESRSVAAI… |
| A0A535XNU5 | 343-543 | None |
| A0A6G8Q708 | 82-267 | None |
| D0LGY7 | 45-234 | None |
| C3GGK0 | 1-169 | None |
| A0A1C6GLF8 | 29-244 | None |
| A0A6I6WEP2 | 9-168 | None |
| A0A7Y4R1R0 | 3-140 | None |
| A0A7Z9I918 | 2-168 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.