DPCstruct | MC34979
Metacluster Properties and Pfam Annotations
| Number of structural domains | 79 |
|---|---|
| Mean domain length (aa) | 178 ± 35 aa |
| Standard deviation of domain lengths | 34.70 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 89.00 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.56 |
| Mean intra-cluster local Distance Difference Test score | 0.54 |
| Mean intra-cluster sequence similarity (%) | 20.19 |
| Pfam Score | 75.70 |
| Assigned Pfam label(s) | CL0123- CL0040- PF02829- CL0250 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| W1U3G9 | 38-205 | MSFVDQDDVIALAEETMAACWKIIGVDMPTPLPRITWHEAMDRYGSDKPDLRFGNEITEVTDFFANTPFRVFQAPYVGAVVMPGGAS… |
| A0A831NU16 | 23-170 | KRLRELGIVDVDLVGGCYLTKKGREIVDTFFKYVKTISDLSNVVERDLKLANYAYGALLRLCTSAESISIVEWRDIFVRYGAKATLI… |
| A0A7V4FYZ7 | 3-124 | None |
| A0A256YBJ3 | 25-216 | None |
| A0A7C0XPS7 | 22-204 | None |
| A0A4S4DT31 | 38-156 | None |
| K1PL73 | 204-405 | None |
| A0A3R7AES3 | 77-293 | None |
| A0A381G847 | 35-235 | None |
| A0A1D2R468 | 24-191 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.