DPCstruct | MC34978
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13460 |
|---|---|
| Mean domain length (aa) | 283 ± 54 aa |
| Standard deviation of domain lengths | 53.95 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 89.51 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.35 |
| Mean intra-cluster local Distance Difference Test score | 0.33 |
| Mean intra-cluster sequence similarity (%) | 10.61 |
| Pfam Score | 88.98 |
| Assigned Pfam label(s) | PF01265- PF06364- CL0103- CL0219- PF01341 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A831JZD4 | 5-264 | GCWIWGTTVRELGIERVLKLSKDIGIKDLFLLVKSVSGIVNFSILESIGKHAIDHDLRIHTWIVCFEDKSVGSITPEDEEYRKYLLT… |
| A0A6D0F5A3 | 29-332 | TLIEAEACDVGFREVRIENGLLLLNGKPLLIRGVNRHEHHPLHGQVMDEQTMVQDILLMKQNNFNAVRCSHYPNHPLWYTLCDRYGL… |
| A0A6P5GZK7 | 185-558 | None |
| T2F5N3 | 8-405 | None |
| R5LLT6 | 170-495 | None |
| A0A1X6PEN0 | 67-422 | None |
| A0A7W0QEP9 | 40-286 | None |
| A0A194VAY1 | 8-323 | None |
| A0A0C2JB06 | 2-230 | None |
| A0A1H9MPV5 | 183-547 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.