DPCstruct | MC34976
Metacluster Properties and Pfam Annotations
| Number of structural domains | 167 |
|---|---|
| Mean domain length (aa) | 170 ± 28 aa |
| Standard deviation of domain lengths | 27.68 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 89.65 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 25.10 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0237 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1Y1RJR2 | 8-177 | ELVRFLRTVDQLEILPRTGYFFAGIRQPESIAAHSYGVALIAMLLADRIKSRVNIERVLRLAILHDTAESLLTDIPNSSFAYMDQAH… |
| A0A0G4IJA4 | 12-189 | SPAALLEFFLICGRLKTTKRAGWVQQGVHQPESVADHMYRMGMMALAFDGEPGHSGERLDFSKVVRMAIVHDLAESIVGDITPSDNV… |
| A0A552DLP9 | 845-1032 | None |
| B9EYA3 | 77-209 | None |
| A0A7R8HAJ6 | 416-589 | None |
| A0A7J2S5L9 | 18-138 | None |
| M4BVK6 | 10-188 | None |
| A0A1G2ICW3 | 9-143 | None |
| A0A5J4JIB6 | 1-147 | None |
| A0A6A2XD66 | 55-205 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.