DPCstruct | MC34974
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 754 ± 92 aa |
| Standard deviation of domain lengths | 92.35 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 77.40 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.56 |
| Mean intra-cluster sequence similarity (%) | 20.13 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0028 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A835Q1V0 | 4-870 | RSLAAESTRAYQGGPLERTFYHDASFFHVDGEIGILYEDSNVFKYPTQYKRMLDWFAVDLEGEHSAMDGGILEEHTEYVVYSIHKIL… |
| A0A1A8PCW7 | 9-574 | YVSALGLLVVGLRELLTGFEENRCSMTYMFEYPEYRRVALPRRMARSYPAYGLYLYGEGLYAQETRHLKLTGTPVLFLPGNAGSYKQ… |
| C9SJ64 | 336-1099 | None |
| M5FYP4 | 2-859 | None |
| A0A109FNB7 | 143-956 | None |
| A0A482V1F6 | 294-1173 | None |
| A0A1E3IRY4 | 294-934 | None |
| A0A4T0RA22 | 554-1189 | None |
| A0A0B1P7L6 | 217-861 | None |
| A0A0L0H6I6 | 2-704 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.