DPCstruct | MC34971
Metacluster Properties and Pfam Annotations
| Number of structural domains | 46 |
|---|---|
| Mean domain length (aa) | 81 ± 8 aa |
| Standard deviation of domain lengths | 8.26 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 86.61 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 50.40 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF00696 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A835PW28 | 2-80 | MASAMNAILLQASFEKIGVEARVQTTFMMQEIAEPYIRRRAIRHLEKRRIVIFGGIGAGTGNPLFSTDTTAALRASDIN |
| A0A6F8Q803 | 7-87 | DYMGMLATVMNALAMQSALEGLGVFTRVISAIRMDEVAEPYIRRRAVRHLEKKRVCIFAAGTGNPYFTTDTAAALRANEMA |
| A0A5N5M2A3 | 174-238 | None |
| A0A812RU93 | 83-163 | None |
| A0A1U8EHR1 | 2-82 | None |
| A0A1A9VJP7 | 595-679 | None |
| A0A447TLW6 | 2-83 | None |
| A0A484YK20 | 2-78 | None |
| A0A1R3KIV2 | 2-80 | None |
| A0A2N9IBZ4 | 591-668 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.