DPCstruct | MC34970
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 190 ± 10 aa |
| Standard deviation of domain lengths | 9.75 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 69.49 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 49.20 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2P2MTY5 | 1-202 | MLLLGHAHCAHERQDLLRNDQHGSLKLHELEPAALQALHELVSLVHNHLKINDQDPAVLSTSTNDHGVCMKDACYEVAKSDLHLLKG… |
| A0A835PQW7 | 1-179 | MIREYIHQKTCLKWNQISLIHKHLIEISGLSSTASIISTESGDESNSIGHSSLIENPVASILWNIDPLVLQDVLLFMVNNFPRTLEG… |
| A0A0L9TY11 | 689-865 | None |
| A0A7J0FJF1 | 6-191 | None |
| A0A2N9G7I8 | 690-875 | None |
| A0A443NNU3 | 78-260 | None |
| A0A835PQS1 | 42-237 | None |
| A0A251N2B5 | 160-364 | None |
| A0A7J7CXN6 | 121-319 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.