DPCstruct | MC34967
Metacluster Properties and Pfam Annotations
| Number of structural domains | 210 |
|---|---|
| Mean domain length (aa) | 120 ± 19 aa |
| Standard deviation of domain lengths | 18.67 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 82.52 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 26.66 |
| Pfam Score | 85.03 |
| Assigned Pfam label(s) | CL0023- PF00137- CL0255- PF00231- CL0105 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A835PF51 | 4-117 | QVDEIGGVVPVGDGIARVYGFNEIQAGEMVEFASGVKGIALNLENENVGIVVFGSDTAIQEGDLVKRTGSIVDVPAGKDMLGRVVDV… |
| A0A7C7KX92 | 2-70 | VVGKIWRISGPLVIAENMKGAQVYEVVEVGDEALIGEIIGLEGDRAIIQVYEDTGGLTVGEKVVGTGKP |
| A0A2G3D3A0 | 144-282 | None |
| A0A2U1QH96 | 64-173 | None |
| A0A1U8FNM3 | 63-194 | None |
| A0A5N6PPI5 | 500-610 | None |
| G8A0B0 | 54-184 | None |
| A0A4C1UKR2 | 113-279 | None |
| C0AH42 | 9-135 | None |
| M7YYF1 | 3-137 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.