DPCstruct | MC34963
Metacluster Properties and Pfam Annotations
| Number of structural domains | 453 |
|---|---|
| Mean domain length (aa) | 74 ± 15 aa |
| Standard deviation of domain lengths | 14.67 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 75.02 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 32.09 |
| Pfam Score | 98.65 |
| Assigned Pfam label(s) | PF16664- PF01576- CL0154- CL0220- CL0229 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6P8GQJ8 | 11-77 | AALERKAGSQRFSENMPHKFEIRSYKVPTFCNHCSSMLWGFMRQGLQCKACKMNVHKHCENNVAPSC |
| A0A498P3N9 | 117-173 | PENGTANGHDFQMHCFEDTTSCKACQMLLRGIFYQGYRCSRCKMAAHKECLGRVPAC |
| A0A7S1Z0J2 | 59-157 | None |
| A0A1I8IPH2 | 94-190 | None |
| A0A182U053 | 52-122 | None |
| A0A3Q0J584 | 645-713 | None |
| A0A821QXN4 | 208-282 | None |
| A0A6P5W678 | 73-167 | None |
| A0A6P5VW88 | 376-431 | None |
| A0A2D4FUH5 | 48-133 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.