DPCstruct | MC3496
Metacluster Properties and Pfam Annotations
| Number of structural domains | 28 |
|---|---|
| Mean domain length (aa) | 89 ± 9 aa |
| Standard deviation of domain lengths | 9.43 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 83.83 |
| Mean fraction of residues predicted as intrinsically disordered | 0.38 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 25.44 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4Q9AWH1 | 22-107 | YQPIYTWRETWPGEGHQDFSGFDGDQSFGRVELENAADLKPGMWKWNAAHLPWVRQEIMPRSGSEETSREACRRVEEHYEKLKAVH |
| A0A7U4LIL0 | 1-108 | MSEPYQPRYQGAPTWPDNVKPNEPVLDFAAHDGDERAGRVYKATGGPQDKQWQWCGAYPSTGWRGNPIMPNSGFEDTARIAVQRCEE… |
| A0A7W5FZZ2 | 26-112 | None |
| A0A7W6J2S7 | 1-91 | None |
| A0A849IFZ9 | 3-93 | None |
| A0A1Q9ANG3 | 6-99 | None |
| A0A7R6XF87 | 22-109 | None |
| A0A530Z3N6 | 45-124 | None |
| A0A3A3HCR0 | 17-112 | None |
| A0A7J4VN86 | 1-69 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.