DPCstruct | MC34955
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 85 ± 8 aa |
| Standard deviation of domain lengths | 8.26 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 90.21 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.90 |
| Mean intra-cluster sequence similarity (%) | 34.87 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A485EET4 | 35-126 | FEEQAKRRVVLGLIVAEVVKQHELKADEGRVREMIEEMASAYQEPEQVVAWYFKNEPQLNEVRSVVLEEQVVDTVLQKATVTDKQVS… |
| U3U3L2 | 1-92 | MLQEIIRTHNLKVDENRVRALIIEIASAYENPNQVIALYFKKKELMNNIRNIVLEELAIEAVITKAKITEKPFKFNELIYHHTYENQ… |
| A0A6H3TJB1 | 152-244 | None |
| A0A7Y3H8X8 | 62-147 | None |
| A0A837Q594 | 64-141 | None |
| A0A2S5TPG0 | 2-82 | None |
| A0A3B0ZHG9 | 6-74 | None |
| A0A2R7P4Y0 | 16-93 | None |
| K2E027 | 27-120 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.