DPCstruct | MC34950
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 244 ± 45 aa |
| Standard deviation of domain lengths | 44.80 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 75.13 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.52 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 24.48 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF10220 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7M7KK43 | 131-314 | HEHCMEFIEGHTRLAFKQGFNDNVGRNAGVAYFRLAQLHRWVDVFEKMVHFFRNVNEIDIDAKFSEVRCSKAYPVALQAYHDNLPPY… |
| A0A3P7MJY9 | 3-240 | PVAVNVNPLSDILQIALGEDITEDADEKSERIPSFSRFLRMQLDAVRSEKSKIYEVPKLELWIKYAKALVEIISPSSEIVTKKLLNQ… |
| A0A7E4RQM1 | 1-188 | None |
| A0A1Y9G8H4 | 1-226 | None |
| A0A6J1J788 | 57-286 | None |
| A0A2J7ZYD5 | 137-464 | None |
| A0A2I0TKW4 | 1-210 | None |
| A0A1D6LL53 | 7-228 | None |
| A0A3Q0JFT1 | 540-770 | None |
| A0A6P6VVE4 | 435-694 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.