DPCstruct | MC3495
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 166 ± 19 aa |
| Standard deviation of domain lengths | 18.91 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 85.92 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 26.32 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7V3YHZ0 | 1-152 | LHGAGDFASLVKLVMPALLIVASLFDTGCNFLLGRWIGKRIGLSFPDVPPFSEWRLPRSVFWAFVLGWVFMLFGGTSFLGRIGVNVQ… |
| A0A367ZMJ6 | 142-323 | ELFLAQKQEFARKIQEFQQQGEGDPQSLQVLLEHFQAWMDFILLLVPVTFIFTWHLLSLAVFYLGALALGARFGFTLTPLPPFATWR… |
| A0A1V5NRL8 | 1-151 | None |
| A0A6B0X6L2 | 90-261 | None |
| A0A7Z2STA7 | 125-313 | None |
| A0A7V2DEU1 | 1-183 | None |
| A0A7X6TJ61 | 2-131 | None |
| A0A836U3S7 | 183-354 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.