DPCstruct | MC34946
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 209 ± 26 aa |
| Standard deviation of domain lengths | 25.75 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 65.78 |
| Mean fraction of residues predicted as intrinsically disordered | 0.72 |
| Mean length-normalized TM-Score | 0.26 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 31.69 |
| Pfam Score | 87.50 |
| Assigned Pfam label(s) | PF12457- CL0449 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3P6TSL1 | 1-217 | MRTSAVRSAVDPNAAGDWTKFGKGDVVRKMMQAMGYKEGEGLGVSGQGIVEPVQATVRKGRGAVGAYGKEAIGPRFGETAAEAQRRE… |
| A0A6G3ME41 | 56-237 | SKTPQISISEDHFGSWEKHTTGFGSKMLEKMGYAQGQGLGKRGSGIIEPIQAVPRQGRATLGAYGSDNNSVYQNSLPTVIEQKPEII… |
| A0A480NGY3 | 129-345 | None |
| B7Q964 | 51-263 | None |
| A0A822DXY2 | 136-365 | None |
| R1CRX4 | 75-315 | None |
| A0A815T2D4 | 1-161 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.