DPCstruct | MC34945
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 133 ± 7 aa |
| Standard deviation of domain lengths | 7.34 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 87.45 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 36.48 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF07842 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7J8HTD7 | 144-273 | MLWFESLLFYGCEEREQEKDDVDVALLPTIVEKVILPKLTVIAENMWDPFSTTQTSRMVGITLKLINGYPSVVNAENKNTQVYLKAL… |
| A0A0B1S353 | 49-178 | MPWYIDCVQAAEGNTDVDPKHEIITGIIPSIIEKVVLPFLIDVVNVEWEPMSLKQSKRLGAVLSGLTDYPKMNVEDSKAFAALAAAV… |
| G5EBK6 | 84-208 | None |
| A0A0B2VU31 | 547-701 | None |
| A0A4Z2AXE9 | 79-209 | None |
| V4AFI7 | 230-361 | None |
| A0A498MHT5 | 657-786 | None |
| A0A3Q2U2I9 | 1-133 | None |
| Q8N2J1 | 1-130 | None |
| A0A5F8HBG8 | 40-166 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.