DPCstruct | MC34944
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 103 ± 12 aa |
| Standard deviation of domain lengths | 11.56 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 84.64 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 21.02 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF06486 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3P6TAN1 | 24-134 | IVGSLLWLIGPRFLLRATAQDAYVKINAPGVSSPEKDSEGNVHEYYVHTLTAVFKDKTTKTLTVGSANRGRPLRTGAYLLLKVNSRN… |
| A0A8B4YNU2 | 2-87 | VAETTVYALTNQPIDHHLGQMGEDVYTYRLRTSDGQGKRRWLTFTADHRLKQRHYLKIDTKGQNVNSWEAVTVSAVPQRARQALKS |
| A0A718Y4W7 | 8-96 | None |
| A0A5M9QWF8 | 18-114 | None |
| A0A3A9A5D6 | 8-119 | None |
| V9W4G2 | 1-89 | None |
| A0A2K2U2P1 | 114-223 | None |
| A0A7Z8EMG8 | 6-97 | None |
| A0A0R1U4V8 | 13-134 | None |
| A0A097B876 | 1-99 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.