DPCstruct | MC34933
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 81 ± 6 aa |
| Standard deviation of domain lengths | 6.10 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 88.32 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 42.40 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0205 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3P6RUZ2 | 1-77 | MMFSPLFMGDTDGAGQVVRGPFAGFRTLEGRPNILRRLATEGKLFTEANLNNFLGQTEIQNVLAYTAPQNGELPSLF |
| A0A368GS35 | 85-165 | DSYLPDPRDSILFSALFMGETDGAGQVVRGPFAGFRTLEGRPHIVRRLATEGKLFTEANINNLLSQTEIQNVLAYTAPQNG |
| A0A0M3J9Q6 | 118-204 | None |
| A0A0B1ST85 | 154-240 | None |
| A0A0B2V753 | 217-286 | None |
| A0A6V7XS50 | 67-151 | None |
| A0A0D6LVJ5 | 277-356 | None |
| A0A3P7KLU4 | 99-181 | None |
| A0A1S0U3A8 | 215-280 | None |
| A0A183CK25 | 316-404 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.