DPCstruct | MC34929
Metacluster Properties and Pfam Annotations
| Number of structural domains | 41 |
|---|---|
| Mean domain length (aa) | 268 ± 65 aa |
| Standard deviation of domain lengths | 65.09 |
| Length coefficient of variation | 0.24 |
| Mean AlphaFold2 pLDDT confidence score | 71.93 |
| Mean fraction of residues predicted as intrinsically disordered | 0.36 |
| Mean length-normalized TM-Score | 0.56 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 29.39 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF13890 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3P6RLS9 | 39-330 | GALPLDEVPMPIAKSVMKRCMDKIFDVENSEEDPNTGRTSQPLLTIPGGAVRSSPAKLRQIKWTPPDSITRRFAMAFTNASLDYIYG… |
| A0A3P8A795 | 3-182 | QNKWTPPNSLTWRFAMAFANASMDSVYGPCAYAQVWLEFVNHLRNYYDSTKDFDVTQPNLSHCLLHQKIEMLQCCISAKRRSFIGST… |
| A0A0M3IV87 | 5-247 | None |
| A0A7I4CMN5 | 247-529 | None |
| A0A5B8MH94 | 252-459 | None |
| A0A287HX40 | 1-163 | None |
| A0A287HX67 | 55-393 | None |
| A0A287HXG4 | 79-417 | None |
| A0A835R776 | 69-322 | None |
| A0A0D9WZC7 | 156-390 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.