DPCstruct | MC34925
Metacluster Properties and Pfam Annotations
| Number of structural domains | 65 |
|---|---|
| Mean domain length (aa) | 126 ± 17 aa |
| Standard deviation of domain lengths | 17.21 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 88.27 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 41.52 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0205 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3P6QFS8 | 3-123 | FLVSSANDPAFFLHHSFIDYIWETWRQGKQPRQNRESDYPRDDIRCNSAAHFARAPMLPFSPMLNIDGLSNEYTVLYMFHIFSIDMR… |
| A0A368GS35 | 198-330 | NDPIFFLHHCFVDFVWEMWRQSRQNRFARETAYPPDIGTCANSQHFSYAQMRPWDKQNRDGLSNEYTDNLFRYAPRATCSRQNPNCG… |
| A0A3P6S036 | 166-314 | None |
| A0A2A6C3B5 | 196-315 | None |
| R7UB97 | 364-508 | None |
| A0A0R3QQ18 | 435-581 | None |
| A0A2A6CB80 | 666-761 | None |
| A0A6V7U0V9 | 43-159 | None |
| A0A3P7ILS7 | 42-150 | None |
| A0A0B1PI26 | 115-232 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.