DPCstruct | MC34922
Metacluster Properties and Pfam Annotations
| Number of structural domains | 61 |
|---|---|
| Mean domain length (aa) | 213 ± 27 aa |
| Standard deviation of domain lengths | 27.34 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 81.63 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.48 |
| Mean intra-cluster local Distance Difference Test score | 0.55 |
| Mean intra-cluster sequence similarity (%) | 18.10 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF10979 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0D6BIX3 | 12-150 | ERVIRKIKRCLALSQSSNENEAATAMRQAQSLMREYRLTEMDVRLSDVGEVESEMSRAKRRPTWDRNLGSVIGEAFSVRSFSRRRWC… |
| A0A829EZW5 | 8-234 | KIVKKVKGLLAIAKDENKDEESQSAFLMAQRLMIQYDIDKADVLEEGEEAEPIGEESVTVYKKLFWWERTLGQIIAKNFRVKMFYNS… |
| A0A1G6QLP6 | 9-236 | None |
| Q4LBQ5 | 250-459 | None |
| A0A6I6FKE4 | 312-524 | None |
| A0A1J5JTG1 | 6-192 | None |
| A0A1L3SXI7 | 186-396 | None |
| A0A7X9L8Z5 | 229-447 | None |
| W4BQ62 | 8-197 | None |
| A0A516X1T6 | 170-384 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.