DPCstruct | MC3492
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 284 ± 32 aa |
| Standard deviation of domain lengths | 31.92 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 83.64 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.57 |
| Mean intra-cluster local Distance Difference Test score | 0.60 |
| Mean intra-cluster sequence similarity (%) | 21.50 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| B9TD48 | 4-235 | DALGDWWRETVSSFRAVTGADREMERFVVYKNFPREVLDMSASRYWVRQILMYLGAPNEWFTEPEEARPQLDERLKLRVLQPATDGT… |
| A0A0G3GYA0 | 24-317 | TRQAVTAALELARLGFACAPEQLMQLAPAQLTELLGSAAAAIGADRRWQPLFPGFPKQVYQESDWQLLATALAHYHSRGEFRLTDID… |
| W8YDA1 | 15-282 | None |
| A0A1Y3NN82 | 529-810 | None |
| A0A1Y5GU52 | 27-299 | None |
| A0A1Q3N3R6 | 1-364 | None |
| A0A031I5S7 | 15-277 | None |
| A0A5C5XM72 | 9-307 | None |
| A0A1I3XAW7 | 1-241 | None |
| A0A1F1GQ75 | 86-395 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.