DPCstruct | MC34919
Metacluster Properties and Pfam Annotations
| Number of structural domains | 30 |
|---|---|
| Mean domain length (aa) | 81 ± 7 aa |
| Standard deviation of domain lengths | 7.38 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 74.54 |
| Mean fraction of residues predicted as intrinsically disordered | 0.54 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 55.06 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF12165 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A453G6K5 | 1-85 | MNEKDWLALVAVHSDSWLLSVAFYFGARFGFDKENRRRLFNMINNLPTIYEVVTGIAKKQSKEKTPNSSSKSSKPSMKVVSATAP |
| A0A1C9ZPI2 | 80-142 | MARKEWLALVAVHSDAWIMSVAFYYGAKLNFEQRKSLFNQMNSSSTLFEVVTGKREAVGLKRG |
| A0A7S3BDD5 | 149-224 | None |
| A0A059CNH6 | 246-325 | None |
| A0A0V0HGK8 | 1-81 | None |
| A0A4D8ZRA8 | 87-176 | None |
| M1A1C8 | 88-165 | None |
| A0A823A5I8 | 85-165 | None |
| A0A287FYW3 | 1-83 | None |
| A0A287FYW6 | 64-146 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.