DPCstruct | MC34918
Metacluster Properties and Pfam Annotations
| Number of structural domains | 5 |
|---|---|
| Mean domain length (aa) | 80 ± 2 aa |
| Standard deviation of domain lengths | 2.40 |
| Length coefficient of variation | 0.03 |
| Mean AlphaFold2 pLDDT confidence score | 79.31 |
| Mean fraction of residues predicted as intrinsically disordered | 0.14 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 61.78 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF00445 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A811P2Q7 | 55-135 | STRHCCATNGCCRSEPLQTFTIHGLWPDYDDGTWPSCCRRTQFDMDKILPLKEVLDKYWPSLYCSKSGTCFSGKGLFWAHE |
| A0A2T7EUQ5 | 46-122 | CCSSNACCRSDRIGWFTIHGLWPSYAHGNGPTCCNNADFDMAKISNLTMELQKYWPSLYCSSPSLCSGGHGSLWAHE |
| A0A287TGY5 | 1-83 | None |
| M7ZU88 | 1-77 | None |
| A0A484NKJ5 | 800-880 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.