DPCstruct | MC34910
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 124 ± 13 aa |
| Standard deviation of domain lengths | 12.80 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 90.31 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.89 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 51.19 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0378 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| T1NJV1 | 1-105 | MPTIKDELDRRQLLYSLLMPVMNLYLSGLDKGKGLYFLFVKSETKTPSGLTARPVLTSYYKSEQLKNRPYDPYHNYTSPTAAILCAD… |
| A0A426XNS1 | 1-119 | MPMIEDELDRRSVLYSLLMPVMSQFLPGLDEGKGMYFLFVKSEARTPGGLIARPVLTSYYKSRHFLSQPFDPYNVLTSPNEAILCLD… |
| A0A565C0D3 | 75-182 | None |
| A0A287HP70 | 111-240 | None |
| A0A6A3CCH9 | 35-174 | None |
| A0A7J7LU58 | 1-115 | None |
| A0A6P4B5D9 | 97-226 | None |
| A0A498KDU7 | 204-333 | None |
| A0A251T7W7 | 2-111 | None |
| A0A2I0IQY5 | 66-203 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.