DPCstruct | MC3491
Metacluster Properties and Pfam Annotations
| Number of structural domains | 61 |
|---|---|
| Mean domain length (aa) | 420 ± 81 aa |
| Standard deviation of domain lengths | 80.53 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 89.16 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.53 |
| Mean intra-cluster sequence similarity (%) | 18.65 |
| Pfam Score | 96.88 |
| Assigned Pfam label(s) | PF06276- CL0016 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5C8X4L6 | 1-253 | YYAGLSFRTLVPKYPAMSPHIKLSTNVHITGEIRTLSEQTTHNGPLMTRILNDILEKDVIFKSYASTIIDEVAGIHFYNEQDEADYQ… |
| A0A0G3GY62 | 454-866 | QDYVWFDNPISIPPATDETEWAKEHVLSRLAVAKEMEQVAKDPHADDIDNAIATLAQVKQVVEKRRRNLPVVPVDFVGVLADSLTIT… |
| A0A1M7CTT4 | 492-1021 | None |
| A0A0H5DPU8 | 125-557 | None |
| A0A3T0KAM1 | 298-795 | None |
| A0A0Q0A1P5 | 19-322 | None |
| A0A1W9I4H3 | 11-411 | None |
| D3BU25 | 101-674 | None |
| A0A2N3SGF9 | 64-519 | None |
| A0A3N4LUL4 | 124-596 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.