DPCstruct | MC34907
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 145 ± 17 aa |
| Standard deviation of domain lengths | 16.54 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 73.50 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 57.84 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A453FCG6 | 13-152 | SRKAFLACPDHSPAAGRSLTPARGAPASSPALISAVQDLYEFICSGPLVERIGYTRERIAESIDRWLWCGSQVSRLFRIDELRLTDA… |
| A0A453FD38 | 13-173 | CSLTVTAATPSRKAFLACPDHSPAAGRSLTPARGAPASSPALISAVQDLYEFICSGPLVERIGYTRERIAESIDRWLWCGSQVSRLF… |
| A0A426ZVX4 | 1-115 | None |
| A0A1D1YKQ6 | 48-194 | None |
| M0ZRM6 | 1-149 | None |
| A0A2P2LMN2 | 70-221 | None |
| A0A444G9B4 | 1-114 | None |
| A0A446NM68 | 36-198 | None |
| I1M5N8 | 57-215 | None |
| A0A5N5G9N8 | 479-625 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.