DPCstruct | MC34903
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 110 ± 6 aa |
| Standard deviation of domain lengths | 5.69 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 86.73 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 26.26 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2D5RTL7 | 11-119 | AFQGKLVKDESEAQESLAGAGRIRTEDSQENIGSCGTSAFCRDYAPVACYLCKKFMPWQDAPHHLVLRDLVEERDRISKETGDLAIA… |
| A0A7Z8QA54 | 2-105 | IILDVADGERGDDPSARIPNKDNEVVGACGTNVFCIKGYEACYVCEKFRPLLDGPHEKFLNSLYVEKDARLKATKSEQYASTKDTLI… |
| A0A485DD99 | 52-163 | None |
| R9B5F4 | 2-113 | None |
| A0A2A2K5Z2 | 800-910 | None |
| A0A7C8B6H8 | 27-137 | None |
| A0A7W9XVI8 | 52-149 | None |
| A0A6L5HA26 | 141-256 | None |
| A0A7S3DFZ7 | 20-122 | None |
| A0A0N1MA62 | 159-272 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.