DPCstruct | MC34902
Metacluster Properties and Pfam Annotations
| Number of structural domains | 29 |
|---|---|
| Mean domain length (aa) | 139 ± 30 aa |
| Standard deviation of domain lengths | 30.02 |
| Length coefficient of variation | 0.22 |
| Mean AlphaFold2 pLDDT confidence score | 89.07 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 33.53 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF20658 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2T1IUW5 | 12-115 | PVRGAKVIEFAKNFLNEVFPLAQGSHADATKYAIEQNKLVVTLKDGSKTGLAHEAQFVGFNGEEANPSEVVLLSNGLHVIIEIDENS… |
| A0A2D5RR71 | 21-136 | DYSKGFLDKTFPLAYGSHKDVVCYMVYFQHMLAFFADGSKSGLQNPAQFVALSGHREAPESLVLVNEGRHVELVLNRHGGNGEKDCA… |
| A0A7J6Q8E2 | 614-735 | None |
| A0A2D5FBX6 | 13-175 | None |
| A0A820BB15 | 156-272 | None |
| A0A813TZ27 | 159-256 | None |
| A0A3A1VWI3 | 86-249 | None |
| A0A814BNM6 | 172-331 | None |
| A0A1E5A0A8 | 109-270 | None |
| A0A4R3IBH3 | 18-192 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.