DPCstruct | MC349
Metacluster Properties and Pfam Annotations
| Number of structural domains | 22 |
|---|---|
| Mean domain length (aa) | 122 ± 16 aa |
| Standard deviation of domain lengths | 16.09 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 83.46 |
| Mean fraction of residues predicted as intrinsically disordered | 0.38 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 24.85 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A442J162 | 1-92 | MLDGIDGRSAGARRYRELLFKLNGELSLELSKAGRRATVQQDMLLRRAALLAMWCENTEAKLVNGEEIDIDAFNVATNTLRRILIDA… |
| A0A534XD60 | 2-135 | KMLRRVLRSVPIDLLDKRSAIGVAARKRREELIDHCGGAEAVSPAQVILIDTAVKTELIVRAAEDYILRQETLVVDHGLLPVVMQRQ… |
| A0A7W4MUF6 | 7-109 | None |
| A0A1E3WD95 | 1-140 | None |
| A0A1E3YFM9 | 58-183 | None |
| A0A4R9VRC5 | 2-118 | None |
| A0A442KKS7 | 16-128 | None |
| A0A0A8K4S5 | 18-134 | None |
| A0A2N8M690 | 1-100 | None |
| B1M1E7 | 8-127 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.