DPCstruct | MC34899
Metacluster Properties and Pfam Annotations
| Number of structural domains | 42 |
|---|---|
| Mean domain length (aa) | 158 ± 18 aa |
| Standard deviation of domain lengths | 18.33 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 71.99 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.55 |
| Mean intra-cluster local Distance Difference Test score | 0.57 |
| Mean intra-cluster sequence similarity (%) | 16.54 |
| Pfam Score | 77.78 |
| Assigned Pfam label(s) | CL0723- CL0192 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4Z2DLX1 | 6-167 | HSSDEIMFPTYRRNPGEIGVKLHISECQPIANSVYSSMNYFLANVREKFEQQILYNTNLLELKWCLEEENDEVFSGFILERIEPDFM… |
| A0A6J8DPQ8 | 146-280 | SYFRGHINLTVTINMYSNNQTAVASNPDMTSYYLSTFQEAVKQGKEHDPKTLISNHFLSDIGVSARVIVSSVISIIVRAFNIESIQA… |
| K1PY70 | 146-287 | None |
| A0A2B4SCK5 | 205-339 | None |
| A0A6S7GCF6 | 1-198 | None |
| A0A6P8H770 | 240-384 | None |
| A0A6P8H963 | 6-147 | None |
| A0A6P8I4T4 | 136-285 | None |
| A0A2G8L695 | 62-200 | None |
| A0A7D9LQL8 | 1-165 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.