DPCstruct | MC34898
Metacluster Properties and Pfam Annotations
| Number of structural domains | 26 |
|---|---|
| Mean domain length (aa) | 399 ± 78 aa |
| Standard deviation of domain lengths | 77.59 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 79.67 |
| Mean fraction of residues predicted as intrinsically disordered | 0.69 |
| Mean length-normalized TM-Score | 0.41 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 23.95 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF13868 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4Z2DIX1 | 1-395 | MKNKKEFSFENPNNNRSMDIRRVKLISQSEWERLQKQLDNNLSETAKVEEKKLELEKIKAQSKEMIKNWTNTLLGGRQKKLEERANR… |
| A0A820HUW9 | 1-242 | MCILTKGDLTRIYDNLERRQRDKDSIKQEMERKNELLQRSMQLTKNWPNTIAGDRERKLQMKKLRDKEAEERKKVLDLEEEKLAAER… |
| A0A0V0QTR8 | 5-468 | None |
| A0A814T5B0 | 1-287 | None |
| A0A507D987 | 1-423 | None |
| A0A5B8MDF7 | 3-453 | None |
| A0A6S7IJ52 | 24-310 | None |
| A0A2K6EKJ9 | 21-363 | None |
| T2MEE5 | 8-364 | None |
| A0A0W8CRD0 | 1-372 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.