DPCstruct | MC34896
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 71 ± 5 aa |
| Standard deviation of domain lengths | 5.14 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 81.65 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 67.54 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5K4FC92 | 288-358 | EIDTSLTTNADLMASRQWKYYIETNEWTRATCALMACLFTRDQMANSTVLGRGGSQRARLPSNLVAYVVTT |
| A0A0R3X9G1 | 269-339 | EIDDMLTQNPQVTSSRHWKYYVETNEWTRATCALMACLFSRDQMANSTVLGRGGSQRERLPTNLVAYVVSK |
| A0A183N5J1 | 1-68 | None |
| A0A3P7N2F9 | 1-81 | None |
| A0A095A217 | 284-353 | None |
| A0A4Z2DCI0 | 21-91 | None |
| A0A2H1CLK1 | 3-64 | None |
| A0A504YDS9 | 144-221 | None |
| A0A075AIE1 | 389-459 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.