DPCstruct | MC34891
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 158 ± 22 aa |
| Standard deviation of domain lengths | 21.73 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 86.93 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 23.57 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF13387 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1F9QUL1 | 115-274 | PAAAEPPPHKDKFRPALFLGEQAGALRVDNLRWLEPTAAAHDFTWVSAAIRPELVKEIYFVTKVQPPGIAGHSLLFYEFEDGGFTDA… |
| A0A7U6QQ87 | 2-142 | AEVDQQVAYERDATNPDLITLTNVRNFDWRTDEDATEHWETRTIDLSKLSGVDVTNSYWMGPLIAHTLVSFRFEDDRPLAFSFEIRK… |
| A0A1V5NMN8 | 11-190 | None |
| A0A1V5UHC1 | 301-463 | None |
| A0A7X1B904 | 2-119 | None |
| A0A2E8RZB1 | 97-250 | None |
| A0A354PJI3 | 22-202 | None |
| A0A3C1QUU9 | 84-253 | None |
| A0A433VLH1 | 71-228 | None |
| A0A239K9R7 | 3-171 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.