DPCstruct | MC3489
Metacluster Properties and Pfam Annotations
| Number of structural domains | 23 |
|---|---|
| Mean domain length (aa) | 292 ± 24 aa |
| Standard deviation of domain lengths | 24.28 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 87.77 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.50 |
| Mean intra-cluster sequence similarity (%) | 16.83 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0368 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| I4B0J8 | 1-351 | MPKEITHCILAERAVHTLAAAASPDKHAVGREIVFIAERLPQLLYFGSVSPDIFFYDIKLPWELRVKHRGLFWGELIHGTQGEDSLA… |
| A1AT46 | 1-293 | MPKEITHWILAERTAQRLAGSGILADIIQAHHAAYLGGAVLPDTLLHLFRGPHSATALHLADRFHDATGNSYAPLIRVETSRGGMLP… |
| D4J0F8 | 2-249 | None |
| A0A651EDZ2 | 1-322 | None |
| A0A2V2GG56 | 67-336 | None |
| A0A1H0QQS3 | 2-280 | None |
| A0A660ZH20 | 1-283 | None |
| A0A7C1DBL7 | 24-325 | None |
| A0A651HRC9 | 75-374 | None |
| A0A6N7X2N0 | 40-340 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.